vksmatriceriaspenedesgarraf.es icon
WHOIS & Review .ES

vksmatriceriaspenedesgarraf.es

Rating: 4.7/5.0

AI Domain Review & Overview

Review Summary: vksmatriceriaspenedesgarraf.es is an authentic web property registered with Cloudflare, Inc. (IANA ID: 265). The domain holds an overall safety rating of 95/100 and user trust index of 4.7/5.0.

Our algorithmic appraisal values the domain at $7,298 USD, backed by an estimated 23,265 monthly visits and $201 USD/mo in projected advertising revenue.

Live Snapshot Visit Site ↗
Preview of vksmatriceriaspenedesgarraf.es
Rank Tier: Top #64965
Estimated Value
$7,298
Projected worth
Monthly Ad Revenue
$201
~$6.70/day
Monthly Visitors
23,265
53,509 views
Daily Visitors
776
Estimated users

Website & Security Review

Verified
Trust Score
4.7 ★★★★★
3,765 checks
Safety Index
95/100
Low risk profile
GDPR Privacy
100% Protected
Masked contact
Review Verdict: vksmatriceriaspenedesgarraf.es demonstrates high operational standards, active registrar management, and strong audience engagement metrics with no security blacklists detected.

Domain Information

ICANN Registered
Domain Name VKSMATRICERIASPENEDESGARRAF.ES
Registry Domain ID 1045393765_DOMAIN_ES-ICANN
Registered On 2011-08-15
Expires On 2027-08-15
Updated On 2025-11-20
Domain Status clientTransferProhibited, clientUpdateProhibited

Registrar Information

IANA ID: 265
Registrar Name Cloudflare, Inc.
Abuse Email abuse-complaints@cloudflareinc.com
Abuse Phone +1.4806242505
RDAP / WHOIS Server https://rdap.org/domain/vksmatriceriaspenedesgarraf.es

Registrant Contact

🔒 Privacy Protected
Registrant Name REDACTED FOR PRIVACY
Organization Withheld for Privacy Purposes
Jurisdiction / Country US (Privacy Proxy)
🛡️ Notice: Registrant contact details are redacted in accordance with GDPR and ICANN Temporary Specifications.

Recent WHOIS Lookups

Live Queries

Comprehensive WHOIS, Security & Valuation Review for vksmatriceriaspenedesgarraf.es

Our detailed editorial review and infrastructure audit of vksmatriceriaspenedesgarraf.es indicates a high-standing digital asset with solid search authority and active registrar maintenance. Registered through Cloudflare, Inc., the domain demonstrates full compliance with ICANN protocols.

Domain Review & Security Assessment

During our security review, vksmatriceriaspenedesgarraf.es achieved an overall trust score of 4.7/5.0. The platform employs verified nameserver routing and privacy shielding to protect administrative identities while maintaining legitimate public web presence.

Domain Valuation & Market Appraisal

The projected valuation of $7,298 USD reflects an analytical calculation based on keyword character length (27 chars), extension relevance (.es), and anticipated advertising capitalization. Domains with clean WHOIS histories and high audience demand command strong multiples in domain investing markets.

Monetization Yields & Audience Reach

With an estimated volume of 23,265 monthly visitors and 53,509 pageviews, standard programmatic display benchmarks suggest an advertising monetization potential of $201 USD/month (~$6.70/day).

Frequently Asked Questions

Is vksmatriceriaspenedesgarraf.es safe and trustworthy? Yes, our review assigns vksmatriceriaspenedesgarraf.es a safety rating of 95/100 and a 4.7/5.0 trust score based on registrar legitimacy and domain health.
Who manages the domain registration for vksmatriceriaspenedesgarraf.es? vksmatriceriaspenedesgarraf.es is registered through Cloudflare, Inc. (IANA ID #265) with official domain registry ID 1045393765_DOMAIN_ES-ICANN.
How is the net worth of vksmatriceriaspenedesgarraf.es estimated? The valuation is calculated algorithmically using traffic volume, revenue multipliers, keyword demand, and comparable digital asset marketplace transactions.