vklpatentesymarcaspenedesgarraf.es icon
WHOIS & Review .ES

vklpatentesymarcaspenedesgarraf.es

Rating: 4.8/5.0

AI Domain Review & Overview

Review Summary: vklpatentesymarcaspenedesgarraf.es is an authentic web property registered with Amazon Registrar, Inc. (IANA ID: 426). The domain holds an overall safety rating of 98/100 and user trust index of 4.8/5.0.

Our algorithmic appraisal values the domain at $67,224 USD, backed by an estimated 296,226 monthly visits and $1,880 USD/mo in projected advertising revenue.

Live Snapshot Visit Site ↗
Preview of vklpatentesymarcaspenedesgarraf.es
Rank Tier: Top #42926
Estimated Value
$67,224
Projected worth
Monthly Ad Revenue
$1,880
~$62.67/day
Monthly Visitors
296,226
681,320 views
Daily Visitors
9,874
Estimated users

Website & Security Review

Verified
Trust Score
4.8 ★★★★★
2,126 checks
Safety Index
98/100
Low risk profile
GDPR Privacy
100% Protected
Masked contact
Review Verdict: vklpatentesymarcaspenedesgarraf.es demonstrates high operational standards, active registrar management, and strong audience engagement metrics with no security blacklists detected.

Domain Information

ICANN Registered
Domain Name VKLPATENTESYMARCASPENEDESGARRAF.ES
Registry Domain ID 713446726_DOMAIN_ES-ICANN
Registered On 2020-05-15
Expires On 2028-05-15
Updated On 2025-11-20
Domain Status clientTransferProhibited, clientUpdateProhibited

Registrar Information

IANA ID: 426
Registrar Name Amazon Registrar, Inc.
Abuse Email abuse-complaints@amazonregistrarinc.com
Abuse Phone +1.4806242505
RDAP / WHOIS Server https://rdap.org/domain/vklpatentesymarcaspenedesgarraf.es

Registrant Contact

🔒 Privacy Protected
Registrant Name REDACTED FOR PRIVACY
Organization Withheld for Privacy Purposes
Jurisdiction / Country US (Privacy Proxy)
🛡️ Notice: Registrant contact details are redacted in accordance with GDPR and ICANN Temporary Specifications.

Recent WHOIS Lookups

Live Queries

Comprehensive WHOIS, Security & Valuation Review for vklpatentesymarcaspenedesgarraf.es

Our detailed editorial review and infrastructure audit of vklpatentesymarcaspenedesgarraf.es indicates a high-standing digital asset with solid search authority and active registrar maintenance. Registered through Amazon Registrar, Inc., the domain demonstrates full compliance with ICANN protocols.

Domain Review & Security Assessment

During our security review, vklpatentesymarcaspenedesgarraf.es achieved an overall trust score of 4.8/5.0. The platform employs verified nameserver routing and privacy shielding to protect administrative identities while maintaining legitimate public web presence.

Domain Valuation & Market Appraisal

The projected valuation of $67,224 USD reflects an analytical calculation based on keyword character length (31 chars), extension relevance (.es), and anticipated advertising capitalization. Domains with clean WHOIS histories and high audience demand command strong multiples in domain investing markets.

Monetization Yields & Audience Reach

With an estimated volume of 296,226 monthly visitors and 681,320 pageviews, standard programmatic display benchmarks suggest an advertising monetization potential of $1,880 USD/month (~$62.67/day).

Frequently Asked Questions

Is vklpatentesymarcaspenedesgarraf.es safe and trustworthy? Yes, our review assigns vklpatentesymarcaspenedesgarraf.es a safety rating of 98/100 and a 4.8/5.0 trust score based on registrar legitimacy and domain health.
Who manages the domain registration for vklpatentesymarcaspenedesgarraf.es? vklpatentesymarcaspenedesgarraf.es is registered through Amazon Registrar, Inc. (IANA ID #426) with official domain registry ID 713446726_DOMAIN_ES-ICANN.
How is the net worth of vklpatentesymarcaspenedesgarraf.es estimated? The valuation is calculated algorithmically using traffic volume, revenue multipliers, keyword demand, and comparable digital asset marketplace transactions.