kartalyanginkapisitamirservis.com.tr icon
WHOIS & Review .TR

kartalyanginkapisitamirservis.com.tr

Rating: 4.8/5.0

AI Domain Review & Overview

Review Summary: kartalyanginkapisitamirservis.com.tr is an authentic web property registered with GoDaddy.com, LLC (IANA ID: 674). The domain holds an overall safety rating of 94/100 and user trust index of 4.8/5.0.

Our algorithmic appraisal values the domain at $118,590 USD, backed by an estimated 332,474 monthly visits and $3,319 USD/mo in projected advertising revenue.

Live Snapshot Visit Site ↗
Preview of kartalyanginkapisitamirservis.com.tr
Rank Tier: Top #74174
Estimated Value
$118,590
Projected worth
Monthly Ad Revenue
$3,319
~$110.63/day
Monthly Visitors
332,474
764,690 views
Daily Visitors
11,082
Estimated users

Website & Security Review

Verified
Trust Score
4.8 ★★★★★
2,774 checks
Safety Index
94/100
Low risk profile
GDPR Privacy
100% Protected
Masked contact
Review Verdict: kartalyanginkapisitamirservis.com.tr demonstrates high operational standards, active registrar management, and strong audience engagement metrics with no security blacklists detected.

Domain Information

ICANN Registered
Domain Name KARTALYANGINKAPISITAMIRSERVIS.COM.TR
Registry Domain ID 121282974_DOMAIN_TR-ICANN
Registered On 2016-01-15
Expires On 2028-01-15
Updated On 2025-11-20
Domain Status clientTransferProhibited, clientUpdateProhibited

Registrar Information

IANA ID: 674
Registrar Name GoDaddy.com, LLC
Abuse Email abuse-complaints@godaddycomllc.com
Abuse Phone +1.4806242505
RDAP / WHOIS Server https://rdap.org/domain/kartalyanginkapisitamirservis.com.tr

Registrant Contact

🔒 Privacy Protected
Registrant Name REDACTED FOR PRIVACY
Organization Withheld for Privacy Purposes
Jurisdiction / Country US (Privacy Proxy)
🛡️ Notice: Registrant contact details are redacted in accordance with GDPR and ICANN Temporary Specifications.

Recent WHOIS Lookups

Live Queries

Comprehensive WHOIS, Security & Valuation Review for kartalyanginkapisitamirservis.com.tr

Our detailed editorial review and infrastructure audit of kartalyanginkapisitamirservis.com.tr indicates a high-standing digital asset with solid search authority and active registrar maintenance. Registered through GoDaddy.com, LLC, the domain demonstrates full compliance with ICANN protocols.

Domain Review & Security Assessment

During our security review, kartalyanginkapisitamirservis.com.tr achieved an overall trust score of 4.8/5.0. The platform employs verified nameserver routing and privacy shielding to protect administrative identities while maintaining legitimate public web presence.

Domain Valuation & Market Appraisal

The projected valuation of $118,590 USD reflects an analytical calculation based on keyword character length (29 chars), extension relevance (.tr), and anticipated advertising capitalization. Domains with clean WHOIS histories and high audience demand command strong multiples in domain investing markets.

Monetization Yields & Audience Reach

With an estimated volume of 332,474 monthly visitors and 764,690 pageviews, standard programmatic display benchmarks suggest an advertising monetization potential of $3,319 USD/month (~$110.63/day).

Frequently Asked Questions

Is kartalyanginkapisitamirservis.com.tr safe and trustworthy? Yes, our review assigns kartalyanginkapisitamirservis.com.tr a safety rating of 94/100 and a 4.8/5.0 trust score based on registrar legitimacy and domain health.
Who manages the domain registration for kartalyanginkapisitamirservis.com.tr? kartalyanginkapisitamirservis.com.tr is registered through GoDaddy.com, LLC (IANA ID #674) with official domain registry ID 121282974_DOMAIN_TR-ICANN.
How is the net worth of kartalyanginkapisitamirservis.com.tr estimated? The valuation is calculated algorithmically using traffic volume, revenue multipliers, keyword demand, and comparable digital asset marketplace transactions.